PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID ORUFI01G08920.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family MYB
Protein Properties Length: 970aa    MW: 106163 Da    PI: 4.8078
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
ORUFI01G08920.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding37.55.5e-1244791248
                     HHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding 12 lvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     l++av+ + g++Wk+Ia++++  Rt+ qc +rwqk+l
  ORUFI01G08920.1 44 LKRAVQTYNGKNWKKIAECFP-DRTDVQCLHRWQKVL 79
                     789******************.************986 PP

2Myb_DNA-binding62.49.4e-2085131148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      +g+W++eEde++v+ v++lG++ W+tIa+ ++ gR +kqc++rw+++l
  ORUFI01G08920.1  85 KGPWSKEEDEIIVQMVNKLGPKKWSTIAQALP-GRIGKQCRERWYNHL 131
                      79******************************.*************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM007171.7E-63281IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.604.7E-194491IPR009057Homeodomain-like
PfamPF002491.3E-94479IPR001005SANT/Myb domain
CDDcd001672.52E-94479No hitNo description
PROSITE profilePS500907.3064479IPR017877Myb-like domain
SuperFamilySSF466894.67E-2259124IPR009057Homeodomain-like
PROSITE profilePS5129431.18380135IPR017930Myb domain
SMARTSM007173.2E-1884133IPR001005SANT/Myb domain
PfamPF002491.2E-1785131IPR001005SANT/Myb domain
CDDcd001675.82E-1687131No hitNo description
Gene3DG3DSA:1.10.10.609.5E-2692134IPR009057Homeodomain-like
SuperFamilySSF466892.37E-15111173IPR009057Homeodomain-like
PROSITE profilePS500905.378132164IPR017877Myb-like domain
Gene3DG3DSA:1.10.10.605.1E-5135171IPR009057Homeodomain-like
SMARTSM0071710136177IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0032875Biological Processregulation of DNA endoreduplication
GO:0003677Molecular FunctionDNA binding
GO:0003713Molecular Functiontranscription coactivator activity
Sequence ? help Back to Top
Protein Sequence    Length: 970 aa     Download sequence    Send to blast
MESLLDLRRL LKKEKSAMNQ KGDDLSMGGP PVRHGVPPKE IGPLKRAVQT YNGKNWKKIA  60
ECFPDRTDVQ CLHRWQKVLN PELVKGPWSK EEDEIIVQMV NKLGPKKWST IAQALPGRIG  120
KQCRERWYNH LNPGINKEAW TQEEEITLIH AHRMTDNSIK NHWNSSVKKK VNSYMSSGLL  180
TQVSCLPLNE YSANCNSSPA MTQQNSEDSG CFAVREVENS SGCSQSSLAK VSCSQVHDTT  240
VPLGCDLQVN ANFDKNEAHD SQSSMGPQAC YTSAEAVASA LPAVHCHVSS SNLDPDQHLQ  300
EDFAQGLNLD MTIDEMPTVP SFADNQTVCS IENHERSLEP YDVAMEVPLS MLSSDSGAEQ  360
KLHFMSEADF NSPNCLKSEL WQDISLQGLL SGPDAVEADS ISRSNHQSDV YSSEADTHFL  420
APPYMPQTSN SSSVMGLADD QSPQMSVPPS LICSNAMTDD APFDNRPGRK EMPLSQAEVV  480
TQSSSSSGDA EMFANPGCSN DRHVPSSTME SIPECGDQQV TNAEEPEASL EKEPSLTQSV  540
TAPDEQDKGA LFYEPPRFPS LDVPFVSCDL VTSGDLQEFS PLGIRQLMHS TMNVCTPMRL  600
WGSPTHDEST GVLLKSAAKS FICTPSILKK RHRDLLSPIP DKRIEKKYGT EKDRGVSDTS  660
STGIQTSCIN ATKDDALITT VLRIERSASS KSLEKKLVFS DENKENLGYT TEQTKDGQSA  720
GNDEHMDEQT TGERSSATNV ATNDDLSGNL QPAGILIEHS GDDPISPDYG KNTMNQKLNT  780
NVKSLSVCKE GVCAKSKPTE LIVEKSSPCI NVDYEYVNIL ADTPGIKRGL ESPSAWKSPW  840
FVDMHFQGSY FTSPADSYDA LGLMKQINVQ TAAALVEARE VLASGGQCDN ISSDKENTGN  900
PDAKKEPGTT KLQTKIMAEG RVLDFECTTP ERSSDKNAGS NLGRYLSSPI PSSHLLKSED  960
FSRLFTRKVG
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h88_C7e-514417117159MYB PROTO-ONCOGENE PROTEIN
1h89_C7e-514417117159MYB PROTO-ONCOGENE PROTEIN
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00505DAPTransfer from AT5G11510Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK3186010.0AK318601.1 Oryza sativa Japonica Group cDNA, clone: J100066E24, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015625869.10.0PREDICTED: myb-related protein 3R-1 isoform X1
TrEMBLA0A0E0MTF70.0A0A0E0MTF7_ORYRU; Uncharacterized protein
STRINGLOC_Os01g12860.10.0(Oryza sativa Japonica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP24953879
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G11510.11e-104myb domain protein 3r-4